Welcome to LookChem.com Sign In|Join Free

Xi'an Julong Bio-Tech Co., Ltd.

Free supplier

Free
supplier
3rd
years
Home>>Products>>Supply 98% Pure CAS 47931-85-1 Pure Calcitonin Acetate Salmon Calcitonin Salmon

Product Certification&
Enterprise Certification

More Detail

Xi'an Julong Bio-Tech Co., Ltd.

Country: China (Mainland)

Business Type:Trading Company

Ms.Victoria

Tel: +008618049624045

Ms.Amber

Tel: +008615877690239

Ms.Florence

Tel: +0086-18792996027

Ms.Helen

Tel: +008618049624045

Ms.Lisa

Tel: +008618291367393

Ms.Doris

Tel: +8618629260427

Ms.Ada

Tel: +008617802922472

Ms.Ellen

Tel: +008618729964529

Mobile: 18049624045

Tel: +008618049624045

Fax:

URL: http://LookChem.com

Province/state: Shaan xi

City: xi'an

Street: Xi'an

MaxCard:


qq
    x
  • Ms.Amber
  • Ms.Florence
  • Ms.Lisa
  • Ms.Ellen
Contact Suppliers

Supply 98% Pure CAS 47931-85-1 Pure Calcitonin Acetate Salmon Calcitonin Salmon

CAS NO.47931-85-1

  • msdsMSDS/COA Download

  • FOB Price: USD: 50.00-60.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,MoneyGram,Other
  • Available Specifications:

    99%(1-24)Gram99%(25-99)Gram99%(100-500)Gram

Contact Supplier

Product Details

Keywords

  • Calcitonin Salmon
  • Calcitonin Salmon powder
  • 47931-85-1

Quick Details

  • ProName: Supply 98% Pure CAS 47931-85-1 Pure Ca...
  • CasNo: 47931-85-1
  • Molecular Formula: C145H240N44O48S2
  • Appearance: white powder
  • DeliveryTime: 3-7 days after payment
  • PackAge: 1kg/Bag,25kg/Drum
  • Port: CHINA PORT
  • ProductionCapacity: 5000 Metric Ton/Month
  • Purity: 99.0%
  • Storage: Store in a cool, dry, ventilated place
  • Transportation: By DHL/Fedex/EMS/TNT/Sea/Air
  • LimitNum: 1 Gram
  • Residue on Ignition: Conforms
  • Heavy Metal: Conforms
  • Valid Period: 2 years
  • Grade: Industrial Grade,Pharma Grade
  • Product Name: Calcitonin Salmon
  • Appearance: White Powder
  • Shipping Origin: China
  • Shelf Life: 2 Years
  • Storage: Cool Dried Storage
  • Assay: Min 98%
  • Sample: Available
  • Standard: Export Standard
  • Trademark: Julong
  • Specification: 99%min
  • COA: Available
  • Package: 1kg/Bag,25kg/Drum
  • MOQ: 10 Gram
  • Test Method: HPLC UV
  • Grade: Pharmaceutical Grade
  • Origin: China

Superiority

Xi'an Julong Bio-Tech Co., Ltd. is located in Xi'an City, Shaanxi Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. And advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, the products are exported to countries all over the world, and have won a good international reputation with excellent quality and excellent service.
The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, constantly strict requirements, set goals, and implement win-win development.

 

1. All inquiries will be replied within 12 hours.

2. Dedication to quality, supply & service.

3. Strictly on selecting raw materials.

3. OEM/ODM Available.

4. Reasonable & competitive price, fast lead time.

5. Sample is available for your evaluation & Formulation development.

6. Faster delivery:Sample order in stock and 3-7 days for bulk production.

7. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.

8. After-Sale Service:

1) International Authorized Third-Party Test For The Products You Demand.

2) 30 Days Warranty of quality of goods.

Details

Products Description

Name: Calcitonin Acetate(Salmon)
Cas No: 47931-85-1(net)
Formula: C145H240N44O48S2
Molecular: 3431.85
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Calcihexal, Calcimar, Cibacalcin, Fortical, Miacalcin, Salcatonin,
Pramlintide, Pramlintide acetate [USAN],187887-46-3,196078-30-5.
Purity:98%
Source: synthetic
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

    

Calcitonin (salmon) is an hypocalcemic hormone produced by the parafollicular C cells of the thyroid or by the ultimobranchial bodies of nonmammalian vertebrates. Calcitonin decreases blood calcium and phosphate due to inhibition of resorption by osteoblasts and osteocytes.
Calcitonin contains a single disulfide bond, which causes the amino terminus to assume the shape of a ring. Alternative splicing of the calcitonin pre-mRNA can yield a mRNA encoding calcitonin gene-related peptide; that peptide appears to function in the nervous and vascular systems.
The calcitonin receptor has been cloned and shown to be a member of the seven-transmembrane, G protein-coupled receptor family.


Benefits
Salmon calcitonin, inhibit the activity of osteoclasts,Inhibit bone salt dissolving, prevent bone calcium release;Improve bone mineral density, effectively relieve pain symptoms;Reduce the risk of fractures;Lower blood calcium.

 

Package & Delivery

By Express

By Air

By Sea

Suitable for under 50kg
Fast: 3-7 days
High cost
Door to door service,
easy to pick up the goods

Suitable for more than 50kg
Fast: 3-7 days
High cost
Port to port,
professional broker needed

Suitable for more than 500kg
Slow: 7-45 days
Low cost
Port to port,
professional broker needed

 

About us

Xi'an Julong Bio-Tech Co., Ltd. is located in Xi'an City, Shaanxi Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. And advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, the products are exported to countries all over the world, and have won a good international reputation with excellent quality and excellent service.
The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, constantly strict requirements, set goals, and implement win-win development.

 

1. All inquiries will be replied within 12 hours.

2. Dedication to quality, supply & service.

3. Strictly on selecting raw materials.

3. OEM/ODM Available.

4. Reasonable & competitive price, fast lead time.

5. Sample is available for your evaluation & Formulation development.

6. Faster delivery:Sample order in stock and 3-7 days for bulk production.

7. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.

8. After-Sale Service:

1) International Authorized Third-Party Test For The Products You Demand.

2) 30 Days Warranty of quality of goods.

 

FAQ

 

Q: What's your MOQ
A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
Q: Is there a discount
A: Yes, for larger quantity, we always support with better price. 

Q: How to confirm the Product Quality before placing orders
A: You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests
Q: How to start orders or make payments
A: You can send our your Purchase order (if your company has), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.

Q: How do you treat quality complaint
First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.

 

Contact us

 

Hot Product