Welcome to LookChem.com Sign In|Join Free

Xi'an Julong Bio-Tech Co., Ltd.

Free supplier

Free
supplier
5th
years
Home>>Products>>Supply 98% Pure Exenatida/Exenatide Acetate Peptide Powder for Sale CAS 141732-76-5

Product Certification&
Enterprise Certification

More Detail

Xi'an Julong Bio-Tech Co., Ltd.

Country: China (Mainland)

Business Type:Trading Company

Ms.Victoria

Tel: +008618049624045

Mobile: 18049624045

Tel: +008618049624045

Fax:

URL: http://LookChem.com

Province/state: Shaan xi

City: xi'an

Street: Xi'an

MaxCard:


qq
    x
  • Ms.Amber
  • Ms.Florence
  • Ms.Lisa
  • Ms.Ellen
Contact Suppliers

Supply 98% Pure Exenatida/Exenatide Acetate Peptide Powder for Sale CAS 141732-76-5

CAS NO.141732-76-5

  • msdsMSDS/COA Download

  • FOB Price: USD: 50.00-60.00 /Gram Get Latest Price
  • Min.Order: 1 Gram
  • Payment Terms: L/C,D/A,D/P,T/T,Other
  • Available Specifications:

    99%(1-24)Gram99%(25-99)Gram99%(100-500)Gram

Contact Supplier

Product Details

Keywords

  • Exenatida
  • Exenatida powder
  • 141732-76-5

Quick Details

  • ProName: Supply 98% Pure Exenatida/Exenatide Ac...
  • CasNo: 141732-76-5
  • Molecular Formula: C186H286N50O62S
  • Appearance: white powder
  • Application: Weight Loss
  • DeliveryTime: 3-7 days after payment
  • PackAge: 1kg/Bag,25kg/Drum
  • Port: CHINA PORT
  • ProductionCapacity: 5000 Metric Ton/Month
  • Purity: 99.0%
  • Storage: Store in a cool, dry, ventilated place
  • Transportation: By DHL/Fedex/EMS/TNT/Sea/Air
  • LimitNum: 1 Gram
  • Residue on Ignition: Conforms
  • Heavy Metal: Conforms
  • Valid Period: 2 years
  • Grade: Industrial Grade,Pharma Grade
  • Product Name: Exenatida
  • Appearance: White Powder
  • Shipping Origin: China
  • Shelf Life: 2 Years
  • Storage: Cool Dried Storage
  • Assay: Min 98%
  • Sample: Available
  • Standard: Export Standard
  • Trademark: Julong
  • Specification: 99%min
  • COA: Available
  • Package: 1kg/Bag,25kg/Drum
  • MOQ: 10 Gram
  • Test Method: HPLC UV
  • Grade: Pharmaceutical Grade
  • Origin: China

Superiority

Xi'an Julong Bio-Tech Co., Ltd. is located in Xi'an City, Shaanxi Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. And advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, the products are exported to countries all over the world, and have won a good international reputation with excellent quality and excellent service.
The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, constantly strict requirements, set goals, and implement win-win development.

 

1. All inquiries will be replied within 12 hours.

2. Dedication to quality, supply & service.

3. Strictly on selecting raw materials.

3. OEM/ODM Available.

4. Reasonable & competitive price, fast lead time.

5. Sample is available for your evaluation & Formulation development.

6. Faster delivery:Sample order in stock and 3-7 days for bulk production.

7. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.

8. After-Sale Service:

1) International Authorized Third-Party Test For The Products You Demand.

2) 30 Days Warranty of quality of goods.

Details

Products Description

Name:Exenatide Acetate, Exenatida      
Cas No:141732-76-5
Formula: C186H286N50O62S
Molecular:4246.62
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
Purity:98%
Appearance: white powder
Source: synthetic
Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

    

Exendin-4 (exenatide), a 39-amino acid peptide originally isolated from the salivary glands of the Gila monster (Heloderma suspectum), differs from exendin-3 only in two positions close to the N-terminus. Application of exenatide causes an increase in acinar cAMP without stimulating amylase release. As an incretin mimetic, exenatide acts as agonist of the glucagon-like peptide-1 (GLP-1) receptor. As GLP-1, though with prolonged activity, exenatide augments the postprandial production of and suppresses secretion of glucagon. For this reason, exenatide has found use as a medication of diabetes II.

Benefits
1. Exenatide augments pancreas response and more appropriate amount of that helps lower the rise in blood sugar from eating.
2. Exenatide also suppresses pancreatic release of glucagon, which prevents hyperglycemia (high blood sugar levels).
3. Exenatide helps slow down gastric emptying and thus decreases the rate at which meal-derived glucose appears in the bloodstream.
4. Exenatide has a subtle yet prolonged effect to reduce appetite, promote satiety via hypothalamic receptors.
5. Exenatide reduces liver fat content. Fat accumulation in the liver or nonalcoholic fatty liver disease (NAFLD) is strongly related with several metabolic disorders.

 

Package & Delivery

By Express

By Air

By Sea

Suitable for under 50kg
Fast: 3-7 days
High cost
Door to door service,
easy to pick up the goods

Suitable for more than 50kg
Fast: 3-7 days
High cost
Port to port,
professional broker needed

Suitable for more than 500kg
Slow: 7-45 days
Low cost
Port to port,
professional broker needed

 

About us

Xi'an Julong Bio-Tech Co., Ltd. is located in Xi'an City, Shaanxi Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. And advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, the products are exported to countries all over the world, and have won a good international reputation with excellent quality and excellent service.
The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, constantly strict requirements, set goals, and implement win-win development.

 

1. All inquiries will be replied within 12 hours.

2. Dedication to quality, supply & service.

3. Strictly on selecting raw materials.

3. OEM/ODM Available.

4. Reasonable & competitive price, fast lead time.

5. Sample is available for your evaluation & Formulation development.

6. Faster delivery:Sample order in stock and 3-7 days for bulk production.

7. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.

8. After-Sale Service:

1) International Authorized Third-Party Test For The Products You Demand.

2) 30 Days Warranty of quality of goods.

 

FAQ

 

Q: What's your MOQ
A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
Q: Is there a discount
A: Yes, for larger quantity, we always support with better price. 

Q: How to confirm the Product Quality before placing orders
A: You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests
Q: How to start orders or make payments
A: You can send our your Purchase order (if your company has), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.

Q: How do you treat quality complaint
First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.

 

Contact us

 

Hot Product