Xi'an Julong Bio-Tech Co., Ltd.
Free supplier
- Free
supplier - 4th
years
Free supplier
Product Certification&
Enterprise Certification
Country: 
China (Mainland)
Business Type:Trading Company
Tel: +008618049624045
Tel: +008615877690239
Tel: +0086-18792996027
Tel: +008618049624045
Tel: +008618291367393
Tel: +8618629260427
Tel: +008617802922472
Tel: +008618729964529
Mobile: 18049624045
Tel: +008618049624045
Fax:
URL: http://LookChem.com
Province/state: Shaan xi
City: xi'an
Street: Xi'an
MaxCard:
Ms.Amber Ms.Florence Ms.Lisa Ms.EllenCAS NO.12279-41-3
99%(1-24)Gram99%(25-99)Gram99%(100-500)Gram
Xi'an Julong Bio-Tech Co., Ltd. is located in Xi'an City, Shaanxi Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. And advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, the products are exported to countries all over the world, and have won a good international reputation with excellent quality and excellent service.
The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, constantly strict requirements, set goals, and implement win-win development.
1. All inquiries will be replied within 12 hours.
2. Dedication to quality, supply & service.
3. Strictly on selecting raw materials.
3. OEM/ODM Available.
4. Reasonable & competitive price, fast lead time.
5. Sample is available for your evaluation & Formulation development.
6. Faster delivery:Sample order in stock and 3-7 days for bulk production.
7. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.
8. After-Sale Service:
1) International Authorized Third-Party Test For The Products You Demand.
2) 30 Days Warranty of quality of goods.
Name: ACTH(1-39), Corticotropin
Cas No: N/A
Formula: C207H308N56O58S
Molecular: 4541.0658
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPDGAEDQLAEAFPLEF
Purity:98%
Appearance: white powder
Source: synthetic
Also known as: Adrenocorticotropin, ACTH, Corticotrophine, Corticotrofina, Cortrophin, Corticotrophinum
Appearance: White Lyophilized Powder
Minimum Order Quantity: 1 g
Test Method: HPLC
Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C.
Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.
Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a cleavage product from a larger precursor proopiomelanocortin (POMC). This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress.
It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R). In mammals, the action of ACTH is limited to those areas of the adrenal cortex in which the glucocorticoid hormones cortisol (hydrocortisone) and corticosterone are formed.
ACTH has little control over the secretion of aldosterone, the other major steroid hormone from the adrenal cortex.
Benifits
Adrenocorticotropic hormone (ACTH), also known as corticotropin (INN, BAN) (brand names Acortan,ACTH, Acthar, Acton, Cortigel, Trofocortina), is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursorcorticotropin-releasing hormone from the hypothalamus).
Its principal effects are increased production and release of cortisol by the cortex of the adrenal gland. Primary adrenal insufficiency, also calledAddison's disease, occurs when adrenal gland production of cortisol is chronically deficient, resulting in chronically elevated ACTH levels; when a pituitary tumor is the cause of elevated ACTH (from the anterior pituitary) this is known as Cushing's disease and the constellation of signs and symptoms of the excess cortisol (hypercortisolism) is known as Cushing's syndrome. Conversely, deficiency of ACTH is a cause of secondary adrenal insufficiency, often as a result of hypopituitarism.
|
By Express |
By Air |
By Sea |
||
|
Suitable for under 50kg |
Suitable for more than 50kg |
Suitable for more than 500kg |
||
Xi'an Julong Bio-Tech Co., Ltd. is located in Xi'an City, Shaanxi Province, China. It is a biotechnology enterprise engaged in the research, development, production and sales of animal and plant extracts, cosmetics, pharmaceutical raw materials and intermediates. The company has complete experimental facilities. And advanced testing instruments ensure the stability of product quality from all aspects. The company has a complete sales service system, the products are exported to countries all over the world, and have won a good international reputation with excellent quality and excellent service.
The company has been adhering to the basic principles of "integrity, quality, service, and win-win" to serve customers, constantly strict requirements, set goals, and implement win-win development.
1. All inquiries will be replied within 12 hours.
2. Dedication to quality, supply & service.
3. Strictly on selecting raw materials.
3. OEM/ODM Available.
4. Reasonable & competitive price, fast lead time.
5. Sample is available for your evaluation & Formulation development.
6. Faster delivery:Sample order in stock and 3-7 days for bulk production.
7. We have strong cooperation with DHL, TNT, UPS, FEDEX, EMS. Or you also can choose your own shipping forwarder.
8. After-Sale Service:
1) International Authorized Third-Party Test For The Products You Demand.
2) 30 Days Warranty of quality of goods.
Q: What's your MOQ
A: For the high value product, our MOQ starts from 1g and generally starts from 10gs. For other low, price product, our MOQ starts from 100g and 1kg.
Q: Is there a discount
A: Yes, for larger quantity, we always support with better price.
Q: How to confirm the Product Quality before placing orders
A: You can get free samples for some products, you only need to pay the shipping cost or arrange a courier to us and take the samples. You can send us your product specifications and requests, we will manufacture the products according to your requests
Q: How to start orders or make payments
A: You can send our your Purchase order (if your company has), or just send a simple confirmation by email or by Trade Manager, and we will send you Proforma Invoice with our bank details for your confirmation, then you can make payment accordingly.
Q: How do you treat quality complaint
First of all, our quality control will reduce the quality problem to near zero. If there is a quality problem caused by us, we will send you free goods for replacement or refund your loss.
